Nct Wattpad

Nct Wattpadnctfanficnctnct127nctdreamnctukpopfanfickpophaechanjaeminrenjuntaeyongmarkjenowayvmarkleejaehyunfanfictionnctffchenlenctfanfiction. Jisung was born in Seoul, South Korea on February 5, 2002. 𓏸O nct d… #detodo # De Todo # amreading # books # wattpad. A Demon walking amongst the earth. Discover short videos related to nct wattpad recommendations english on TikTok. Search: Twice Imagines Wattpad. NCT members kpop profile (2022 updated) …. Where life brings her back to the danger, but this time it's not the same. what is your favorite nct wattpad story? started: 1:32 PM (aest), wednesday, 26/01/2022. See more ideas about nct, nct dream, wattpad. "LET ME EAT MY BREADSTICKS IN PEACE" seven chaotic and stupid friends navigate the ups and downs of college and young adult life the spin off to seven hours | ljn published: august 1, 2021 final update: started: may 22, 2021 completed: may 30, 2022 @orangeyultree ©2021-2022. Cerita pendek keseharian baby Jisung bersama ke. When autocomplete results are available use up and down arrows to review and enter to select. TWICE IMAGINES Toga Himiko. NCT Members Profile (Updated!). Lee Tae-yong (Hangul: 이태용) referred to as Taeyong (Hangul: 태용) is a South Korean rapper, singer, dancer and songwriter, born in Sillim-dong, Gwanak-gu, Seoul on July 1, 1995. 2018 Jul 15 - Explore Cloudcutton's board "wattpad nct" on Pinterest. #1 - Jaemin (12/9/2021) #1 - Nana (15/9/2021) start : 7/7/2021 finish : 5/8/2021. nctmarknctnctdreammarkleenct127ncthaechanmarknctunctrenjunnctjisungnctjenohaechannctjaeminnctchenlekpopnctjohnnyncttaeyongnctjaehyunjaeminnctyuta. The group debuted its first unit NCT U with members Taeil, Taeyong, Doyoung, Ten, Jaehyun, and Mark through a digital single 'The 7th Sense' on April 9, 2016. Watch popular content from the following creators: jisung (REAL)(@kiz4hae), …. NCT Members Profile: NCT Facts and Ideal Types NCT (엔시티), an acronym for ‘Neo Culture Technology’, is a new boy group concept. Tons of awesome NCT desktop wallpapers to download for free. Read the most popular nct stories on Wattpad, the world's largest social storytelling platform. Genre: Slice of Life, Angst in Some Parts, Comedy in Some Parts. but what will happen when donghyuck appears in their lives and threatens to brea. / ot9 twice x reader imagines #wattpad #fanfiction Credits to all the owners of the gifs and pictures Oct 17, 2019 - This Pin was ⠀ ⠀ ⠀ ⠀n. Read Fan Meeting - Jaehyun/Jung Yoonoh X Male!Reader (NCT) from the story K-Pop X Male Reader (Male groups only) by best_boy_rocky (필릭스) with …. 3m Followers, 8 Following, 2,727 Posts - See Instagram photos and videos from NCT DREAM OFFICIAL (@nct_dream). Watch popular content from the following creators: Yua(@grassasahi), CLOSED(@smmami_), jaeyful(@jaeyful), 잼(@najaemthelove), allure(@haecstatic), ry(@haekizes), rurutoo(@feelsmoodies), inactive | busy. # 1 Baby Chick {Little! Jisung & NCT} by Aira 277K 7. 24 Narcissa Malfoy x female reader (smut!) 25 Luna …. 6K 71 SMUTT AND FLUFF Slow updates. #wattpad #fanfiction @donghyucked: get ur life straight yesterday u said that ur. NCT 127 Members Profile (Updated!). January 17, 2022 Quotes tagged as "kpop" Showing 1-30 of 30. 9M views Discover short videos related to nct wattpad recommendation on TikTok. Street racing AU COMPLETED Completed winwin yangyang liuyangyang +18 more # 2 𝐒𝐄𝐂𝐑𝐄𝐓 • 𝘫𝘰𝘩𝘯𝘯𝘺 𝘴𝘶𝘩 by 𝐁𝐫𝐢𝐚 ༉‧₊˚ 18. During a bank robbery, you're surprised to see the criminal recognise you. April 9, 2016: Made his debut on the sub-unit NCT U with. nctsmutnctnct127nctdreamnctimaginenctfluffkpopsmutjaehyunnctutaeyongkpopwayvjaeminhaechanyutajungwoojohnnyjenodoyoungrenjun. 29 Pansy Parkinson x female reader. (CC)🤪Chaotic 7 DREAM Meets Our Chaotic InterviewㅣHot SauceㅣQuestion. #wattpad #misteri-getaran [Part Terakhir+Epilog di PRIVATE ️] "Ya anggap aja klo gue tu bodyguard nya Lo selama disini. He is the primary antagonist of Fate/EXTRA Twice Imagines OPEN Sequel Nayeon X Reader pt 2 The platform claims to have an audience of more than 90 million users, who can directly interact with the writers and share their opinions with fellow readers Inclusive, várias fic's das outras meninas, tanto do blackpink, como do twice, eu irei postar lá. Discover short videos related to nctwattpad on TikTok. Welcome to NCT 127 Official YouTube Channel!. Which society is split in half by dom's and subs. Nct x Male reader | Korean eye makeup, Asian eye makeup, Ulzzang makeup Article from wattpad. 1 day ago · Reader from the story Hetalia x Male Reader by akazxki_ (Akazuki Sakura) with 1,064 reads malereaderinsert Wattpad scheduled for offline maintenance On Tuesday, November 17 between 9:00 AM and 11:00 AM UTC (4:00 - 6:00 AM EST), Wattpad will be down for 2 hours to perform a "Pervert!". · Search: Twilight X Reader Wattpad. NCT is a multinational group under SM Entertainment, it has four different units: NCT Dream, NCT 127, WayV and the rotational unit NCT U. 27 HIGHEST RANKINGS: #111 in twice [2019 nct, jaehyun, boyfriend 27 HIGHEST RANKINGS: #111 in twice [2019 TWICE CRAZY IMAGINES I Need You You x Nayeon Wattpad nct, jaehyun, boyfriend nct, jaehyun, boyfriend. NCT's Lee Haechan There were two rules: 1. Jun 17, 2022 · Search: Twice Imagines. Jun 17, 2022 · Search: Twice Imagines Wattpad. lucasnctnctlucaswongyukheiwayvnctukpopnct127nctlucasmarkncttaeyongnctdreamyukheixuximarkleenct2018winwinjungwootennctjaehyun. NCT is a boy group under SM Entertainment. Touch device users, explore by. NCT Dream - Up To You (Lyric Video)INTL:EP is out now! Get it here: https://smarturl. When autocomplete results are available use up and down arrows to review and enter. after you’re both cleaned, he falls asleep within your arms in no time, and he looks …. Sunrise, Sunset (NCT x Reader) by luna🌙 24. (UPLOAD ULANG) Link Cerita: https://my. Oneshots/imagines mainly smutts mature nct wattys2019 +4 more # 4. they’re a hopeless romantic, the type to daydream about marrying their best friend a. 4K 54 As an aspiring writer, you decided to follow your dreams and take the risk into facing a completely new world, away from your comfort zone. Taeyong and his seven friends are the most popular dom's to go to to train subs, more specifically to help damaged and. jisung’s ideal type would be so cute, all bubbly and smiley like a little ray of sunshine. Nct whatsapp yüklemişte yazışıyolarmışta falan yani #fanfiction #Fanfiction #amreading #books #wattpad. " Inspired by the Percy Jackson . 제가 준비한 선물 잘 받았나영??한해를 마무리하는 시즈니들 올해도 고생많았다고 주는 선물이에요. Discover short videos related to nct wattpad on TikTok. Aug 9, 2019 - [bottom male reader] REQUESTS ARE {OPEN} all requests get 3 parts! wattpad. Discover short videos related to jisung nct wattpad on TikTok. 24 Narcissa Malfoy x female reader (smut!) 25 Luna Lovegood x female reader (smut!) 26 Tom Riddle x female reader (smut!) 27 Remus Lupin x femalre reader (smut!) 28 Fred Weasley x female reader (smut!) part 2. Fans of Wattpad, can now read their favourite stories right from their PC. NCT/WayV's Liu Yangyang The thrill of speeding through the finish line was …. The group consists of members divided into multiple sub-units to be based in major cities around the …. On December 17, 2013 he was introduced as a member of SM Entertainment's pre-debut trainees program SMROOKIES. You can also upload and share your favorite NCT desktop wallpapers. Rabu, 13 Okt 2021 12:04 WIB Tonton NCT 127 Life in Gapyeong Episode 11 di Sini! NCT 127 Life in Gapyeong berlanjut ke episode 11. Watch popular content from the following creators: Yua(@grassasahi), CLOSED(@smmami_), jaeyful(@jaeyful), 잼(@najaemthelove), allure(@haecstatic), ry(@haekizes), rurutoo. The group currently has 23 members and consists of Taeyong, Taeil, Johnny, Yuta, Kun, Doyoung, Ten, Jaehyun, WinWin, Jungwoo, Lucas, Mark, Xiaojun, Hendery , Renjun, Jeno, Haechan, Jaemin, YangYang , Shotaro, Sungchan, Chenle, and Jisung. Watch popular content from the following creators: 💚(@littlenjm), …. He is one of two Japanese members in NCT. NCT - Empathy 2018 Tracklist:0. One s… #fiksipenggemar # Fiksi Penggemar # amreading # books # wattpad. NCT DREAM OFFICIAL (@nct_dream) • Instagram photos and videos. Read Things NCT once said from the story 24th member; of NCT by cuty-minmin (Purple) with 716 reads. nctfanfictionnctnctdreamnct127nctuhaechannctfanfickpopfanfictionjaeminmarknctffjenorenjunchenletaeyongwayvmarkleejisungjaehyun. [highest] #1 in nctfanfic #1 Xiaojun Meet Chenyug Nct's fluffy, talented, and sweet first female member. Watch popular content from the following creators: rini ° ༉‧(@neoluvv), CLOSED(@smmami_), …. Standing out even further as the unique group they are, their music and aesthetics are just as distinct as the members themselves. ‘Let’s Not Fall In Love!,’ A Wattpad Story written by author Lazynim can be reached out by this link below! https://www. Discover short videos related to nct wattpad recommendations on TikTok. He is the center, main rapper, main dancer, and leader of NCT and NCT 127. [ nct mafia au ] "I'll whip you until you say you're mine, baby girl," Lee Taeyong, being born into a mafia family, always has been exposed to the dirty things. Welcome to NCT DANCE Official Youtube Channel. between a girl and seven different guys that love her in different ways. fire drill ➧ lee haechan by dearhyucks. Taeil being a sarcastic little shit would joke about it for a moment before taking it seriously, keen to try it with you as long as you were comfortable with everything. Discover jisung nct wattpad 's popular videos. Nct x male reader wattpad best budget pistol red dot reddit famous aerospace engineers what happens when someone blocks you on discord another word for feel like Non-Idol AU / Coffee Shop AU. Read NCT 2018 EMPATHY from the story 24th member; of NCT by cuty-minmin (Purple) with 526 reads. October 12, 2020: Made his debut on the sub-unit NCT U with the second full album, NCT Resonance Pt. Touch device users, explore by touch or with swipe gestures. NCT's 3rd album "Universe" is out now!Listen and download on your favorite platform: https://smarturl. He is the primary antagonist of Fate/EXTRA Twice Imagines OPEN Sequel Nayeon X Reader pt 2 The platform …. a rich CEO of a famous company is looking for a partner in crime,, he stumbles upon you. NCT_OFFICIAL_JP (@NCT_OFFICIAL_JP) / Twitter. NCT 2021 YearDream : Stage 1. Watch popular content from the …. Non of these are real, it's only an imagine. Read -02- from the story snapchat nct [DISCONTINUED] by WAVYMIN (e i t h n e ) with 4,142 reads. From hard-hitting electropop to smooth R&B tracks, you always need to expect. Discover nct wattpad recommendations english 's po…. Who are some of the famous NCT fanfic authors on Wattpad…. TWICE IMAGINES Toga Himiko X Reader Lemon Wattpad 27 HIGHEST RANKINGS: #111 in twice [2019 An Archive of Our Own, a project of the Organization for Transformative Works Read everytime he gave you butterflies 🦋 from the story NCT Jung Jaehyun imagines by seoltangsweett (🎀🧸 ) with 2,242 reads Read everytime he gave you butterflies 🦋 1 day ago · Search: Bully X Bullied Reader. it/NCT_Universe🪐 'Universe (Let's Play Ball)' MV: http. 𝙣𝙖 𝙟𝙖𝙚𝙢𝙞𝙣 𝙛𝙡𝙪𝙛𝙛 𝗰𝗼𝗺𝗽𝗹𝗲𝘁𝗲 "Daddy!" "I'm not your dad!" Where Lee Haneul wakes up and becomes a mom. 7M views Discover short videos related to nct x reader on wattpad on TikTok. 3M views Discover short videos related to nct wattpad. [ENDING SOON] Wattpad 27M followers. lee donghyuck, a mischievous star that turns us all lovestruck by his charms, finds himself wrapped around Completed. donde te doy layouts para decorar tu acc 🏩. He is the lead dancer, sub-vocalist, and the sub-rapper of NCT 127 and NCT U. it/PRETTYMUCH-INTLEPKeep up to date with PRETTYMUCH:Follo. NCT promotes in different sub-units. Read -prologue- from the story snapchat nct [DISCONTINUED] by WAVYMIN (e i t h n e ) with 6,519 reads. Jung Sungchan (Hangul: 정성찬) referred to as Sungchan (Hangul: 성찬) is a South Korean rapper, born in Seoul, South Korea on September 13, 2001. donde te doy layouts para decorar tu acc 🏩. 1K 23 It all started when he found pacifiers in his pile of fansign gifts, And maybe he realizes he needs caregivers cuz he always gets hurt in headspace, Then there's Daddy nct softhours jeno +22 more # 2 unexpected 𝐧𝐚 𝐣𝐚𝐞𝐦𝐢𝐧 by !! nina♡ 89. nctlucasnctlucaswongyukheinctunct127wayvyukheinctmarknctjungwooncttennctdreamnctjohnnyxuxincttaeyongnctwinwinkpopnctkunnct2018nctjaehyun. ⭒ nct dream ↳ when you bring a bunch of crackheads together in an app. As a group with unlimited members hailing from all over the world and a rotational subunit concept, NCT is as diverse as they come. to/awaken_digNCT Japan Official Twitterhttp://twitter. REKOMENDASI WATTPAD NCT [Kumpulan cerita yang pernah aku baca] *Belum berhenti, cuma lagi rest publish. [highest] #1 in nctfanfic #1 Xiaojun Meet Chenyug Nct's fluffy, …. Jisung (지성) is a South Korean singer and lyricist under SM Entertainment. Discover nct wattpad recommendations 's popular vi…. Aug 6, 2021 - Cerita pendek keseharian baby Jisung bersama ke-6 Hyungnya. Kpop Usernames Bts Monsta X Nct Hyuna Ace Exo Wattpad - Nct facts and ideal types nct (엔시티), an acronym for 'neo culture technology', is a new boy group concept. Taeil: That’s a bit kinky for you. 7m views discover short videos related to nct x reader on wattpad on tiktok. (CC)🤪Chaotic 7 DREAM Meets Our Chaotic InterviewㅣHot Sauceㅣ. Whether an aspiring writer or creating fan fiction. Name: Wattpad for PC Size: […]. Oct 30, 2020 - Nct x Male Reader - [33] 《Yuta》 - Wattpad. The current sub-units are: NCT U, NCT 127, NCT Dream and WayV. nct yuta college athlete au "Let's stop acting. Taeil: That's a bit kinky for you. tt/0sRewINjs7"Matahariku sudah terbenam, kini saatnya bulanku muncul. NCT (엔시티) Members Complete Profile, Facts, and TMI. Nakamoto Yuta (Kanji: 中本悠太) better known as Yuta (Hangul: 유타) is a singer, rapper, and dancer, born in Kadoma, Osaka, Japan on October 26, 1995. Only later then you learn that your high school admirer and sweetheart now runs a global crime. Nct x male reader wattpad best www. Taeil being a sarcastic little shit would joke about it for a moment before taking it seriously, keen to try it with …. after you're both cleaned, he falls asleep within your arms in no time, and he looks …. In 2014, he participated with other NCT-co members on the variety TV. 2M views Discover short videos related to nct wattpad angst on TikTok. nctffnctnctdreamnct127haechanjaeminncturenjunjenokpopchenlejisungmarknctfanficmarkleewayvtaeyongnctdreamffkpopffnctfanfiction. Trailer Wattpad NCT "Sun&Moon". Read -04- from the story snapchat nct [DISCONTINUED] by WAVYMIN (e i t h n e ) with 2,993 reads. # 1 Race You | YANGYANG by lost_in_neocity 167K 11. Answer (1 of 2): I really really reaaallly want you to be as sane as possible. mark and jeno were 100% sure …. July 10, 2016: Made his debut on the sub-unit NCT 127 with the first mini-album, NCT #127. Discover nctwattpad 's popular videos. NCT 127 Life in Gapyeong mencapai episode akhir. 3M views Discover short videos related to nct wattpad recommendations male reader on TikTok. 5m Followers, 0 Following, 147 Posts - See Instagram photos and videos from TAEYONG (@taeoxo_nct). Discover nct wattpad recommendation 's popular vid…. [GERMAN] In diesem Buch wirst du verschiedene Reaktionen der 23 Jungs von NCT finden, einige sind lustig, die anderen traurig und bewegend. Watch popular content from the following creators: Sun(@_stheriel_), Markeu’s …. 27 HIGHEST RANKINGS: #111 in twice [2019 nct, jaehyun, boyfriend 27 HIGHEST RANKINGS: #111 in twice [2019 TWICE CRAZY IMAGINES I Need You …. Never wander the dark streets alone at night. If you see a person wearing a black leather jacket with a golden phoenix Completed teenlove leedonghyuck gangau. October 12, 2020: Made his debut on the project unit NCT 2020 with the second full album, NCT Resonance Pt. but, as things unfold, the unlikely happens a chenle · nctdream. nct wattpad recommendations male reader 2. See more ideas about nct, cartoon jokes, wattpad. nctangstnctnctfluffnctdreamnct127haechannctimaginenctujaeminangstwayvjenomarkkpopjisungchenletaeyongjaehyunmarkleekpopangst. On July 7, 2016, Seoul based unit NCT 127 became NCT's second unit to debut with members Johnny, Haechan, Mark, Winwin, Taeyong, Jaehyun, Yuta, Taeil, Jungwoo, and Doyoung. May 31, 2021 - Explore Karen Bui's board "Wattpad" on Pinterest. 27 HIGHEST RANKINGS: #111 in twice. Sep 08, 2021 · Timed (Jeno x Male Reader) 11 parts. #NCT127 特集 お楽しみいただけていますか ⁉️ 📌 8月 東京ドーム公演の映像& #WOWOW 独占のメンバーインタビューで構成された90分のスペシャル番組 📌 9月 2019年のワールドツアーの日本公演など NCT 127の魅力をぜひチェックしてください 😊 https:// bit. Nana: mama mark cooed the little baby to sleep Markie: mama mark …. Half mortal, half god, that makes you a demigod. in which a girl finds herself in a highschool full of cliché characters. This is boyxboy content if you're not into that just ignore this book. He wouldn’t enjoy it as much as the others but he’d still love to make sure you were being pleasured. NCT reaction to thigh riding. mark and jeno were 100% sure they were soulmates, and this made both of them very happy. NCT/WayV's Liu Yangyang The thrill of speeding through the finish line was enough to keep anyone alive. ROYALJAEM。2020 ❜ sequel out !! !! chapter count may be high but most . 23 Harry Potter x female reader (smut!) part 2. ‘Let’s Not Fall In Love!’. •inicio: 18-06-2019 •Fin : Wattpad. A Demon walking amongst the earth ( Male Demon Reader X Kill La Kill) Ryuko Matoi was transferring to Honnoji academy, but when she isn't the only …. Explore the latest videos from hashtags: #nctwattpad, …. Never the same//NCT✓by ˡᵒᵛᵉ ᵒᶠ ʸᵒᵘʳ ˡⁱᶠᵉ. What is Twice Imagines Wattpad. [ TO THE WORLD~ ] [ Hola Sijeuni ] [ NCT IN THE HOUSE ] [Hey You] Kumpulan meme NCT ot21💚. What was your favorite part? Did 7 DREAM answer your question? If so, were they spicy? 🥵🎉NCT DREAM Question Parade 🎉Let us know your favorite moments and. NCT x Male Reader Imagines [bottom male reader] …. nctbxb nct nct127 bxb nctdream jaeyong markhyuck wayv jaehyun johnny taeyong johnten fluff yuwin kpop ten mark nctff angst haechan. read fan meeting - jaehyun/jung yoonoh x male!reader (nct) from the story k-pop x male reader (male groups only) by best_boy_rocky (필릭스) with 4,614 reads. Jan 2, 2021 - [16+] Putus? Tapi gue gak mau ©jenoooworld2020 #fiksipenggemar # Fiksi Penggemar # amreading # books # wattpad. He wouldn't enjoy it as much as the others but he'd still love to make sure you were being pleasured. Read stories about #chenle, #college, and #angel on Wattpad, recommended by HAENGELS. In 2019, he debuted in the K-pop supergroup SuperM. 1 day ago · Reader from the story Hetalia x Male Reader by akazxki_ (Akazuki Sakura) with 1,064 reads malereaderinsert Wattpad …. twitter | nct by cн-erι colα 781K 43K 40 get out of my dms pls -and lemme get …. Tonton keseruannya di sini! Rabu, 13 Okt 2021 20:46 WIB Member NCT 127 Terbagi 2 Kubu, Mana Penjahat vs Penduduk? Episode terbaru NCT 127 Life in Gapyeong makin rusuh. It is a unique community of writers and readers from around the world. you two seem to have a connection from the first time you laid eyes on each othe nctff. HD wallpapers and background images. NCT 127 Members Profile: NCT 127 Facts, NCT 127 Ideal Type NCT 127 (엔씨티 127) is the second sub-unit of the boy group NCT. highest rank: #1 leejeno #1 nctdream #1 nct. Little did you know that you jungwoo nct marklee +22 more # 10 Sweetest Pie- [ hybrid NCT 127 ] by yutapinkytoe 6K 302 9. 💫 nomin mini au // to my love jn is the owner of a popular anonymous twitter account dedicated to his unrequited love, and jm is one of his followers who uses his dms as a diary to express his feelings for his best friend. Please follow her on her fun adventures as NCT's 24th member nctu jeno winwin +22 more # 3 Nct Imagines by cleblahhhh 497K 3. com Nct x Male reader What happens when Nct gets a new member and they end up getting along alittle too well Read to find out more. 𝘴𝘵𝘰𝘱 𝘴𝘦𝘯𝘥𝘪𝘯𝘨 𝘮𝘦 𝘴𝘵𝘳𝘦𝘢𝘬𝘴 𝘰𝘳 𝘪'𝘭𝘭 𝘥𝘳𝘰𝘱 𝘬𝘪𝘤𝘬 𝘺𝘰𝘶 𝘴𝘰 𝘩𝘢𝘳𝘥 𝘺𝘰𝘶 𝘸𝘰𝘯'𝘵 𝘣𝘦 𝘢𝘣𝘭𝘦 𝘵𝘰 𝘳𝘦𝘮𝘦𝘮𝘣𝘦𝘳 𝘢𝘯𝘺𝘵. Nct One Shots +18 100k ️ 500k ️ 1M ️ Smut ️ One Shots ️ •Todos los derechos a sus respectivos autores. It brings hundreds of thousands such stories straight to you across multiple genres to choose from. "LET ME EAT MY BREADSTICKS IN PEACE" seven chaotic and stupid friends navigate the ups …. When autocomplete results are available use up and down arrows to …. NCT DREAM CHATROOM X YOU by ° 我爱你. Jump to Comments Night Mode We found at least 10 Websites Listing below when search with paul x reader lemon on Search Engine Creepypasta Stories - Wattpad Wattpad Marco x Reader - Little Blue Bird Ch There are three folders: Everyone, Teen and Mature Saved from s1311 Saved from s1311. Nct x male reader wattpad Read Fan Meeting - Jaehyun/Jung Yoonoh X Male ! Reader ( NCT ) from the story K-Pop X Male Reader ( Male groups only) by best_boy_rocky (필릭스) with 4,614 reads. nct127, leetaeyong, kimdoyoung. "she's the only one he listens to". "your lips on mine or your last name with mine" Nct dream 00line Renjun,jeno, . 170 Wattpad ideas in 2021. Watch popular content from the following creators: NCIT'26(@weirdoszonee), nikki ᵒᵗ²³🌱 …. 86 21 10 · Surprise, Surprise! { Qian Kun Series } · I Hear You { Lee Jeno Fanfic }. NCT 127's Japan 1st Full Album 'Awaken' has been released on Apr 17th, 2019. 8,611 Likes, 25 Comments - Nct Memes (@lucasbeiber) on Instagram: "Wayv has a new project called rainbow V and the logo is designed by ten (ᴍʏ ᴘғᴘ). He is the maknae of the boy group NCT and its sub-units NCT Dream and NCT U. Nct Au's (@nct_au_) / Twitter.